PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen02g022290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family WOX
Protein Properties Length: 358aa    MW: 40218.6 Da    PI: 7.5476
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen02g022290.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.81.6e-1749109257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       ++R+++ +eq+++Le+ F++   +p ++e++++ +kl    ++ +++V++WFqNr+ + k+
  Sopen02g022290.1  49 KPRWNPRPEQIRILEAIFNSgMVNPPRDEIRKIRAKLqeygQVGDANVFYWFQNRKSRSKH 109
                       89*****************99*************************************995 PP

2Wus_type_Homeobox111.93.5e-3648111265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++kq
   Sopen02g022290.1  48 PKPRWNPRPEQIRILEAIFNSGMVNPPRDEIRKIRAKLQEYGQVGDANVFYWFQNRKSRSKHKQ 111
                        689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-637108IPR009057Homeodomain-like
SuperFamilySSF466892.57E-1241115IPR009057Homeodomain-like
PROSITE profilePS5007110.38245110IPR001356Homeobox domain
SMARTSM003894.9E-947114IPR001356Homeobox domain
CDDcd000867.48E-848111No hitNo description
PfamPF000463.9E-1549109IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0030010Biological Processestablishment of cell polarity
GO:0048825Biological Processcotyledon development
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCNSH HHQWQHDINS SIIQQRPPCN PEERSPEPKP RWNPRPEQIR  60
ILEAIFNSGM VNPPRDEIRK IRAKLQEYGQ VGDANVFYWF QNRKSRSKHK QRHLQAKAQQ  120
QQQHNNNNNS SHQPIITSSS SSSDKSSPNS LTFSIGTSNV MDLLNSPTSS VNQQNYNEFL  180
SNEQPFFFTV QPPAVVPTHD HSAMSQGFCF QDSSTFSPHS SSSGLLLNEW MGISTTNSKK  240
DENDKINLQS QLMTYTLTST VSPLATTTIP TISHIQGVTV DPNDGGPTRS TVFINDVAFE  300
VGIGPFNVRE VFGEDAVLIH SSGEPLITNE WGITIQPLQH GAFYYLLRTS SIASTHHI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1906630.0FJ190663.1 Solanum lycopersicum cultivar M82 COMPOUND INFLORESCENCE (S) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015065385.10.0PREDICTED: WUSCHEL-related homeobox 9-like
TrEMBLB6E0Y50.0B6E0Y5_SOLLC; COMPOUND INFLORESCENCE
STRINGSolyc02g077390.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59422335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45980.16e-72WUSCHEL related homeobox 8